Update README.md

README.md

@@ -46,7 +46,7 @@ Contact map prediction aims to determine whether two residues, $i$ and $j$, are
 
 ### Data Instances
 
-For each instance, there is a string of the protein sequences, a sequence for the contact labels. The each of the sub-labels "[2, 3]" indicates the 3rd residue are in contact with the 4th residue (start from index 0). See the [Contact map prediction dataset viewer](https://huggingface.co/datasets/Bo1015/contact_prediction_binary/viewer/default/test) to explore more examples.
+For each instance, there is a string of the protein sequences, a sequence for the contact labels. Each of the sub-labels "[2, 3]" indicates the 3rd residue are in contact with the 4th residue (start from index 0). See the [Contact map prediction dataset viewer](https://huggingface.co/datasets/Bo1015/contact_prediction_binary/viewer/default/test) to explore more examples.
 
 ```
 {'seq':'QNLLKNLAASLGRKPFVADKQGVYRLTIDKHLVMLAPHGSELVLRTPIDAPMLREGNNVNVTLLRSLMQQALAWAKRYPQTLVLDDCGQLVLEARLRLQELDTHGLQEVINKQLALLEHLIPQLTP'
@@ -62,12 +62,12 @@ The average  for the `seq` and the `label` are provided below:
 
 ### Data Fields
 
-- `seq`: a string containing the protein seqeunce
+- `seq`: a string containing the protein sequence
 - `label`: a string containing the contact label of each residue pair.
 
 ### Data Splits
 
-The CNN/DailyMail dataset has 3 splits: _train_, _validation_, and _test_. Below are the statistics for Version 3.0.0 of the dataset.
+The contact map prediction dataset has 3 splits: _train_, _validation_, and _test_. Below are the statistics of the dataset.
 
 | Dataset Split | Number of Instances in Split                |
 | ------------- | ------------------------------------------- |