inputs
stringlengths 55
647
| labels
stringlengths 29
655
|
|---|---|
[biological_process] <extra_id_0> [cellular_component] <extra_id_1> [molecular_function] <extra_id_2> [sequence] TESLVLSPAPAKPKRA | <extra_id_0> Chromosome condensation <extra_id_1> Chromosome ### Nucleus <extra_id_2> Dna binding <extra_id_3> |
[molecular_function] <extra_id_0> [biological_process] <extra_id_1> [sequence] TVKVTVTGAAGQIGYALLFR | <extra_id_0> L-malate dehydrogenase (nad+) activity <extra_id_1> Tricarboxylic acid cycle <extra_id_2> |
[cellular_component] <extra_id_0> [biological_process] <extra_id_1> [sequence] ASEDTAEAAAPSA | <extra_id_0> Photosystem i ### Chloroplast thylakoid membrane <extra_id_1> Photosynthesis <extra_id_2> |
[cellular_component] <extra_id_0> [sequence] MSKRAMKKIIPLITLFVVTLVG | <extra_id_0> Extracellular region <extra_id_1> |
[cellular_component] <extra_id_0> [molecular_function] <extra_id_1> [sequence] MELSLLLFLALLLGLLLLLF | <extra_id_0> Endoplasmic reticulum membrane <extra_id_1> Metal ion binding ### Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen <extra_id_2> |
[cellular_component] <extra_id_0> [molecular_function] <extra_id_1> [sequence] GLIDVRCYDSSQCE | <extra_id_0> Extracellular region <extra_id_1> Toxin activity ### Potassium channel regulator activity <extra_id_2> |
[cellular_component] <extra_id_0> [sequence] SHTCEICAFAACAGC | <extra_id_0> Extracellular region <extra_id_1> |
[molecular_function] <extra_id_0> [family] <extra_id_1> [sequence] GGSVDSAAAEEVFESNCASCHGADLSGAGPDLTQV | <extra_id_0> Metal ion binding ### Electron transfer activity ### Heme binding <extra_id_1> Cytochrome c-like domain <extra_id_2> |
[biological_process] <extra_id_0> [cellular_component] <extra_id_1> [sequence] XQVWNPIGQPKFETF | <extra_id_0> Photorespiration ### Reductive pentose-phosphate cycle <extra_id_1> Chloroplast <extra_id_2> |
[biological_process] <extra_id_0> [sequence] MLNERFSILVLLLILLTFSLG | <extra_id_0> Xylan catabolic process <extra_id_1> |
[molecular_function] <extra_id_0> [cellular_component] <extra_id_1> [sequence] LEIADLAQYVVDLTAR | <extra_id_0> Carbohydrate binding <extra_id_1> Extracellular region <extra_id_2> |
[molecular_function] <extra_id_0> [biological_process] <extra_id_1> [cellular_component] <extra_id_2> [sequence] VVGGDECNINEHRSL | <extra_id_0> Serine-type peptidase activity ### Toxin activity <extra_id_1> Proteolysis <extra_id_2> Extracellular region <extra_id_3> |
[cellular_component] <extra_id_0> [molecular_function] <extra_id_1> [sequence] SNTSHQDFHSFYGTNLMIGG | <extra_id_0> Mitochondrial inner membrane <extra_id_1> Cytochrome-c oxidase activity <extra_id_2> |
[molecular_function] <extra_id_0> [sequence] IPLDPVAGYKEPA | <extra_id_0> Rna binding <extra_id_1> |
[biological_process] <extra_id_0> [cellular_component] <extra_id_1> [sequence] MAITAAASRLGTEPF | <extra_id_0> Photosynthesis <extra_id_1> Phycobilisome ### Plasma membrane-derived thylakoid membrane <extra_id_2> |
[molecular_function] <extra_id_0> [biological_process] <extra_id_1> [sequence] IALQSPAGAARIRDYLYNELSK | <extra_id_0> Serine-type endopeptidase activity <extra_id_1> Proteolysis <extra_id_2> |
[cellular_component] <extra_id_0> [molecular_function] <extra_id_1> [sequence] ACLDIGNSCRED | <extra_id_0> Extracellular region <extra_id_1> Toxin activity <extra_id_2> |
[molecular_function] <extra_id_0> [cellular_component] <extra_id_1> [family] <extra_id_2> [biological_process] <extra_id_3> [sequence] FNALGLSTRDLVALSGAHTIGQAR | <extra_id_0> Metal ion binding ### Heme binding <extra_id_1> Extracellular region <extra_id_2> Haem peroxidase <extra_id_3> Hydrogen peroxide catabolic process ### Response to oxidative stress <extra_id_4> |
[biological_process] <extra_id_0> [molecular_function] <extra_id_1> [cellular_component] <extra_id_2> [sequence] VVGGDECNINEHRSL | <extra_id_0> Proteolysis <extra_id_1> Toxin activity ### Serine-type peptidase activity <extra_id_2> Extracellular region <extra_id_3> |
[molecular_function] <extra_id_0> [sequence] GVIAWELQHNEPGRKDSTAG | <extra_id_0> Hormone activity <extra_id_1> |
[cellular_component] <extra_id_0> [molecular_function] <extra_id_1> [biological_process] <extra_id_2> [sequence] ADDKNPLEECFCEDDDYCEG | <extra_id_0> Extracellular region <extra_id_1> Toxin activity <extra_id_2> Defense response to bacterium ### Killing of cells of another organism ### Apoptotic process <extra_id_3> |
[biological_process] <extra_id_0> [cellular_component] <extra_id_1> [sequence] MAAYLDPTGQY | <extra_id_0> Actin filament organization <extra_id_1> Cytoplasm ### Nucleus <extra_id_2> |
[biological_process] <extra_id_0> [cellular_component] <extra_id_1> [sequence] MAAYLDPTGQY | <extra_id_0> Actin filament organization <extra_id_1> Cytoplasm ### Nucleus <extra_id_2> |
[molecular_function] <extra_id_0> [cellular_component] <extra_id_1> [sequence] GCCSYPPCFATNSGYC | <extra_id_0> Toxin activity ### Acetylcholine receptor inhibitor activity ### Ion channel regulator activity <extra_id_1> Host cell postsynaptic membrane ### Extracellular region <extra_id_2> |
[biological_process] <extra_id_0> [molecular_function] <extra_id_1> [cellular_component] <extra_id_2> [sequence] DTRPPGFTPFR | <extra_id_0> Defense response <extra_id_1> Toxin activity ### Hormone activity <extra_id_2> Extracellular space <extra_id_3> |
[molecular_function] <extra_id_0> [cellular_component] <extra_id_1> [sequence] KPCCSIHDNSCCGI | <extra_id_0> Toxin activity <extra_id_1> Extracellular region <extra_id_2> |
[molecular_function] <extra_id_0> [cellular_component] <extra_id_1> [sequence] GPSFCKADEKPCEYHADCCNCCLSGICAPSTNWILPGCSTSSFFKI | <extra_id_0> Toxin activity ### Sodium channel regulator activity <extra_id_1> Extracellular region <extra_id_2> |
[cellular_component] <extra_id_0> [sequence] GSLVKLVSTLLSLVPSLMKG | <extra_id_0> Extracellular region <extra_id_1> |
[cellular_component] <extra_id_0> [sequence] CAPECRSFCPDQKCLKDCGCI | <extra_id_0> Extracellular region ### Nematocyst <extra_id_1> |
[cellular_component] <extra_id_0> [molecular_function] <extra_id_1> [biological_process] <extra_id_2> [sequence] QGGAGWPPIPP | <extra_id_0> Extracellular region <extra_id_1> Toxin activity <extra_id_2> Regulation of blood pressure <extra_id_3> |
[biological_process] <extra_id_0> [molecular_function] <extra_id_1> [cellular_component] <extra_id_2> [sequence] SIYERCELARELINR | <extra_id_0> Defense response to bacterium ### Killing of cells of another organism <extra_id_1> Lysozyme activity <extra_id_2> Extracellular region <extra_id_3> |
[molecular_function] <extra_id_0> [biological_process] <extra_id_1> [cellular_component] <extra_id_2> [sequence] ADPRNPLEECFRETD | <extra_id_0> Toxin activity <extra_id_1> Defense response to bacterium ### Killing of cells of another organism ### Apoptotic process <extra_id_2> Extracellular region <extra_id_3> |
[biological_process] <extra_id_0> [cellular_component] <extra_id_1> [molecular_function] <extra_id_2> [sequence] QGGPPRPQIPP | <extra_id_0> Regulation of blood pressure <extra_id_1> Extracellular region <extra_id_2> Toxin activity <extra_id_3> |
[cellular_component] <extra_id_0> [biological_process] <extra_id_1> [molecular_function] <extra_id_2> [sequence] QZKRPPGFSPFRK | <extra_id_0> Extracellular region <extra_id_1> Defense response ### Vasodilation ### Regulation of blood pressure <extra_id_2> Toxin activity ### Hormone activity <extra_id_3> |
[molecular_function] <extra_id_0> [cellular_component] <extra_id_1> [biological_process] <extra_id_2> [sequence] ALAGTIIAGASLTFKILDEV | <extra_id_0> Toxin activity <extra_id_1> Nematocyst ### Extracellular region ### Membrane ### Other organism cell membrane <extra_id_2> Monoatomic ion transport ### Killing of cells of another organism <extra_id_3> |
[cellular_component] <extra_id_0> [molecular_function] <extra_id_1> [sequence] RQRHRDCDKPPDKTN | <extra_id_0> Extracellular region <extra_id_1> Toxin activity <extra_id_2> |
[biological_process] <extra_id_0> [molecular_function] <extra_id_1> [sequence] TPLWSLMQDLMM | <extra_id_0> Nucleotide metabolic process <extra_id_1> Adenosine deaminase activity ### 2'-deoxyadenosine deaminase activity <extra_id_2> |
[molecular_function] <extra_id_0> [cellular_component] <extra_id_1> [biological_process] <extra_id_2> [sequence] KRRPPGFTPFR | <extra_id_0> Toxin activity ### Hormone activity <extra_id_1> Extracellular region <extra_id_2> Defense response ### Regulation of blood pressure ### Vasodilation <extra_id_3> |
[cellular_component] <extra_id_0> [biological_process] <extra_id_1> [sequence] AVPDVAFNAYG | <extra_id_0> Extracellular region <extra_id_1> Defense response to fungus ### Defense response to gram-positive bacterium ### Killing of cells of another organism ### Defense response to gram-negative bacterium <extra_id_2> |
[cellular_component] <extra_id_0> [biological_process] <extra_id_1> [sequence] SNRSPSLRLRF | <extra_id_0> Extracellular region <extra_id_1> Neuropeptide signaling pathway <extra_id_2> |
[cellular_component] <extra_id_0> [biological_process] <extra_id_1> [sequence] SNRSPSLRLRF | <extra_id_0> Extracellular region <extra_id_1> Neuropeptide signaling pathway <extra_id_2> |
[cellular_component] <extra_id_0> [molecular_function] <extra_id_1> [biological_process] <extra_id_2> [sequence] QQWPRDPAPIPP | <extra_id_0> Extracellular region <extra_id_1> Toxin activity <extra_id_2> Regulation of blood pressure <extra_id_3> |
[molecular_function] <extra_id_0> [cellular_component] <extra_id_1> [sequence] VEVATVKNCGKKLLATPR | <extra_id_0> Isomerase activity <extra_id_1> Extracellular region <extra_id_2> |
[biological_process] <extra_id_0> [molecular_function] <extra_id_1> [cellular_component] <extra_id_2> [sequence] GFGSLFKFLAKKVAK | <extra_id_0> Defense response to bacterium <extra_id_1> Toxin activity <extra_id_2> Extracellular region <extra_id_3> |
[cellular_component] <extra_id_0> [sequence] GIGSALAKAAKLIEGMV | <extra_id_0> Extracellular region <extra_id_1> |
[cellular_component] <extra_id_0> [molecular_function] <extra_id_1> [sequence] SVLEIGLMLQEETEKNPKTSYSI | <extra_id_0> Extracellular region <extra_id_1> Toxin activity <extra_id_2> |
[cellular_component] <extra_id_0> [molecular_function] <extra_id_1> [sequence] EAGEECDCGTPENPCCDAAT | <extra_id_0> Extracellular region <extra_id_1> Toxin activity <extra_id_2> |
[biological_process] <extra_id_0> [cellular_component] <extra_id_1> [sequence] TDTEFEAAGGGVR | <extra_id_0> Adaptive immune response ### Innate immune response ### Blood coagulation <extra_id_1> Extracellular region <extra_id_2> |
[cellular_component] <extra_id_0> [biological_process] <extra_id_1> [molecular_function] <extra_id_2> [sequence] MVSEAIAALKEREGSSEFAIGKKKE | <extra_id_0> Nucleosome ### Nucleus <extra_id_1> Nucleosome assembly <extra_id_2> Dna binding <extra_id_3> |
[molecular_function] <extra_id_0> [biological_process] <extra_id_1> [sequence] IVGGTEVTPGEIPYQLSFQD | <extra_id_0> Serine-type peptidase activity <extra_id_1> Proteolysis <extra_id_2> |
[cellular_component] <extra_id_0> [biological_process] <extra_id_1> [sequence] KPSPDRFYGLM | <extra_id_0> Extracellular region <extra_id_1> Neuropeptide signaling pathway <extra_id_2> |
[cellular_component] <extra_id_0> [biological_process] <extra_id_1> [molecular_function] <extra_id_2> [sequence] SLLEFGMMILEE | <extra_id_0> Extracellular region <extra_id_1> Lipid catabolic process <extra_id_2> Calcium-dependent phospholipase a2 activity ### Calcium-independent phospholipase a2 activity <extra_id_3> |
[biological_process] <extra_id_0> [molecular_function] <extra_id_1> [sequence] IVGGTEVTPGEIPYQLSFQD | <extra_id_0> Proteolysis <extra_id_1> Serine-type peptidase activity <extra_id_2> |
[cellular_component] <extra_id_0> [molecular_function] <extra_id_1> [sequence] KHSLPDLPYDYGA | <extra_id_0> Mitochondrial matrix <extra_id_1> Superoxide dismutase activity ### Manganese ion binding <extra_id_2> |
[cellular_component] <extra_id_0> [sequence] YFDPFSLDVWDPFQA | <extra_id_0> Cytoplasm <extra_id_1> |
[molecular_function] <extra_id_0> [cellular_component] <extra_id_1> [sequence] DVDETHTLGHXFXEL | <extra_id_0> Metal ion binding ### Lipid binding <extra_id_1> Extracellular region <extra_id_2> |
[cellular_component] <extra_id_0> [sequence] SSADSLPXHGAGXMP | <extra_id_0> Mitochondrial matrix <extra_id_1> |
[molecular_function] <extra_id_0> [cellular_component] <extra_id_1> [sequence] ADXQPGDSTDKLLAQKQDDV | <extra_id_0> Oxygen carrier activity <extra_id_1> Extracellular region <extra_id_2> |
[cellular_component] <extra_id_0> [biological_process] <extra_id_1> [sequence] MALPLLEYKPT | <extra_id_0> Plasma membrane-derived thylakoid membrane ### Phycobilisome <extra_id_1> Photosynthesis <extra_id_2> |
[molecular_function] <extra_id_0> [biological_process] <extra_id_1> [sequence] GLTDQKSAPPGL | <extra_id_0> Serine-type peptidase activity <extra_id_1> Proteolysis <extra_id_2> |
[cellular_component] <extra_id_0> [molecular_function] <extra_id_1> [sequence] RLSKKPGKVKE | <extra_id_0> Chromosome ### Nucleus <extra_id_1> Dna binding <extra_id_2> |
[cellular_component] <extra_id_0> [molecular_function] <extra_id_1> [biological_process] <extra_id_2> [sequence] SYPNKQPYGPSGFWM | <extra_id_0> Extracellular region <extra_id_1> Cellulase activity <extra_id_2> Cellulose catabolic process <extra_id_3> |
[molecular_function] <extra_id_0> [sequence] KDALEHTGFAPK | <extra_id_0> Calcium ion binding <extra_id_1> |
[molecular_function] <extra_id_0> [biological_process] <extra_id_1> [sequence] SPPFTSDQDLYTDSR | <extra_id_0> Metal ion binding <extra_id_1> Hydrogen peroxide catabolic process <extra_id_2> |
[molecular_function] <extra_id_0> [biological_process] <extra_id_1> [cellular_component] <extra_id_2> [sequence] RPPGFTPFRIA | <extra_id_0> Toxin activity <extra_id_1> Defense response <extra_id_2> Extracellular region <extra_id_3> |
[cellular_component] <extra_id_0> [molecular_function] <extra_id_1> [sequence] FRGHDKKDKKIQKK | <extra_id_0> Ribonucleoprotein complex ### Ribosome <extra_id_1> Rrna binding <extra_id_2> |
[cellular_component] <extra_id_0> [molecular_function] <extra_id_1> [sequence] FRGHAKGDKKNQKK | <extra_id_0> Ribonucleoprotein complex ### Ribosome <extra_id_1> Rrna binding <extra_id_2> |
[molecular_function] <extra_id_0> [cellular_component] <extra_id_1> [sequence] GHAKKDKKIQKK | <extra_id_0> Rrna binding <extra_id_1> Ribonucleoprotein complex ### Ribosome <extra_id_2> |
[cellular_component] <extra_id_0> [molecular_function] <extra_id_1> [sequence] GHAKGDKKVSKK | <extra_id_0> Ribonucleoprotein complex ### Ribosome <extra_id_1> Rrna binding <extra_id_2> |
[molecular_function] <extra_id_0> [cellular_component] <extra_id_1> [sequence] FRGHAKGDKKNQKK | <extra_id_0> Rrna binding <extra_id_1> Ribonucleoprotein complex ### Ribosome <extra_id_2> |
[biological_process] <extra_id_0> [cellular_component] <extra_id_1> [molecular_function] <extra_id_2> [sequence] VPGGDECNINEHRSL | <extra_id_0> Proteolysis <extra_id_1> Extracellular space <extra_id_2> Toxin activity ### Serine-type endopeptidase activity <extra_id_3> |
[molecular_function] <extra_id_0> [biological_process] <extra_id_1> [sequence] AKLDETLTMLKALTDAKGVPGNEREARDVM | <extra_id_0> Aminopeptidase activity ### Metallopeptidase activity <extra_id_1> Proteolysis <extra_id_2> |
[cellular_component] <extra_id_0> [sequence] DRVYIHPFHLLVYS | <extra_id_0> Extracellular region <extra_id_1> |
[cellular_component] <extra_id_0> [biological_process] <extra_id_1> [sequence] NSATTAVYSFQDWVSA | <extra_id_0> Host cell nucleus ### Host cell ### Virion component <extra_id_1> Symbiont entry into host cell ### Monoatomic ion transmembrane transport ### Viral penetration into host nucleus <extra_id_2> |
[molecular_function] <extra_id_0> [cellular_component] <extra_id_1> [biological_process] <extra_id_2> [sequence] INWKGIAAMAKKLL | <extra_id_0> Toxin activity <extra_id_1> Extracellular region <extra_id_2> Defense response to bacterium ### Defense response to fungus ### Innate immune response ### Killing of cells of another organism <extra_id_3> |
[biological_process] <extra_id_0> [cellular_component] <extra_id_1> [molecular_function] <extra_id_2> [sequence] INWKGIAAMKKLL | <extra_id_0> Defense response to bacterium ### Defense response to fungus ### Innate immune response ### Killing of cells of another organism <extra_id_1> Extracellular region <extra_id_2> Toxin activity <extra_id_3> |
[cellular_component] <extra_id_0> [biological_process] <extra_id_1> [sequence] EEGGSPPPVVI | <extra_id_0> Extracellular region <extra_id_1> Regulation of blood pressure <extra_id_2> |
[molecular_function] <extra_id_0> [cellular_component] <extra_id_1> [sequence] GLCCPMRWSSSEG | <extra_id_0> Toxin activity <extra_id_1> Extracellular region <extra_id_2> |
[molecular_function] <extra_id_0> [biological_process] <extra_id_1> [cellular_component] <extra_id_2> [sequence] FLPIIGKLLSGLL | <extra_id_0> Toxin activity <extra_id_1> Defense response to bacterium ### Defense response to fungus ### Chemotaxis ### Killing of cells of another organism <extra_id_2> Extracellular region <extra_id_3> |
[cellular_component] <extra_id_0> [biological_process] <extra_id_1> [sequence] QHSTDYDEEEEDRAKLHLDAR | <extra_id_0> Extracellular region <extra_id_1> Adaptive immune response ### Innate immune response ### Blood coagulation <extra_id_2> |
[biological_process] <extra_id_0> [cellular_component] <extra_id_1> [sequence] QHSTDYDEEEEDRAKLHLDAR | <extra_id_0> Adaptive immune response ### Innate immune response ### Blood coagulation <extra_id_1> Extracellular region <extra_id_2> |
[molecular_function] <extra_id_0> [cellular_component] <extra_id_1> [sequence] HAGDLGNIVAGSDGV | <extra_id_0> Metal ion binding ### Superoxide dismutase activity <extra_id_1> Chloroplast <extra_id_2> |
[molecular_function] <extra_id_0> [cellular_component] <extra_id_1> [sequence] MLKLHGFSVSNYYNMVKLALLEKG | <extra_id_0> Glutathione transferase activity <extra_id_1> Cytoplasm <extra_id_2> |
[molecular_function] <extra_id_0> [cellular_component] <extra_id_1> [sequence] MDYLITFYHSPQTNS | <extra_id_0> Glutathione transferase activity <extra_id_1> Cytoplasm <extra_id_2> |
[biological_process] <extra_id_0> [sequence] VAGPFRIPPLRREFQ | <extra_id_0> Xenobiotic metabolic process ### Defense response to bacterium ### Defense response to fungus ### Killing of cells of another organism <extra_id_1> |
[molecular_function] <extra_id_0> [sequence] TEFATNDGGQR | <extra_id_0> Lyase activity ### Heparin binding <extra_id_1> |
[biological_process] <extra_id_0> [cellular_component] <extra_id_1> [molecular_function] <extra_id_2> [sequence] NSELINAILGSPTLFGEV | <extra_id_0> Chemical synaptic transmission ### Neuropeptide signaling pathway <extra_id_1> Synapse ### Extracellular region <extra_id_2> Hormone activity <extra_id_3> |
[molecular_function] <extra_id_0> [cellular_component] <extra_id_1> [sequence] SETGNTVTVKGFSPLR | <extra_id_0> Toxin activity <extra_id_1> Extracellular space <extra_id_2> |
[biological_process] <extra_id_0> [molecular_function] <extra_id_1> [sequence] EQPGGDKVNLGYFTN | <extra_id_0> Defense response to fungus ### Polysaccharide catabolic process ### Chitin catabolic process ### Killing of cells of another organism <extra_id_1> Chitin binding <extra_id_2> |
[molecular_function] <extra_id_0> [cellular_component] <extra_id_1> [sequence] YNPASNQCQGF | <extra_id_0> Serine-type endopeptidase inhibitor activity <extra_id_1> Extracellular region <extra_id_2> |
[biological_process] <extra_id_0> [cellular_component] <extra_id_1> [molecular_function] <extra_id_2> [sequence] MLTITSYFGFLLAALTITSALLIGLNKIRLI | <extra_id_0> Photosynthesis <extra_id_1> Chloroplast thylakoid membrane ### Cytochrome b6f complex <extra_id_2> Electron transporter, transferring electrons within cytochrome b6/f complex of photosystem ii activity <extra_id_3> |
[cellular_component] <extra_id_0> [molecular_function] <extra_id_1> [biological_process] <extra_id_2> [sequence] MLTITSYFGFLLAALTITSALLIGLNKIRLI | <extra_id_0> Chloroplast thylakoid membrane ### Cytochrome b6f complex <extra_id_1> Electron transporter, transferring electrons within cytochrome b6/f complex of photosystem ii activity <extra_id_2> Photosynthesis <extra_id_3> |
[biological_process] <extra_id_0> [sequence] SGANVLTFGAGSRLTVL | <extra_id_0> Adaptive immune response <extra_id_1> |
[family] <extra_id_0> [cellular_component] <extra_id_1> [biological_process] <extra_id_2> [molecular_function] <extra_id_3> [sequence] MDTRLLVIAAPVLVAASWALFNIGRLAIQQIQRLSR | <extra_id_0> Photosystem ii psby <extra_id_1> Chloroplast thylakoid membrane ### Photosystem ii <extra_id_2> Photosynthesis <extra_id_3> Manganese ion binding <extra_id_4> |
[cellular_component] <extra_id_0> [biological_process] <extra_id_1> [sequence] MEAFSYVLILTLALVTLFFAVAFRDPPKYDK | <extra_id_0> Plasma membrane-derived thylakoid membrane ### Photosystem ii reaction center <extra_id_1> Photosynthesis <extra_id_2> |
[cellular_component] <extra_id_0> [molecular_function] <extra_id_1> [biological_process] <extra_id_2> [sequence] MAILISYFCFLLIFFLFTLILFFGLNKIRLI | <extra_id_0> Chloroplast thylakoid membrane ### Cytochrome b6f complex <extra_id_1> Electron transporter, transferring electrons within cytochrome b6/f complex of photosystem ii activity <extra_id_2> Photosynthesis <extra_id_3> |
[cellular_component] <extra_id_0> [biological_process] <extra_id_1> [sequence] GRGASSNYVRL | <extra_id_0> Extracellular region <extra_id_1> Neuropeptide signaling pathway <extra_id_2> |
[cellular_component] <extra_id_0> [biological_process] <extra_id_1> [sequence] MGEVFAGGFALLVVLFILLIIIGASWLY | <extra_id_0> Membrane <extra_id_1> Sporulation resulting in formation of a cellular spore <extra_id_2> |
[biological_process] <extra_id_0> [cellular_component] <extra_id_1> [sequence] METLVYTFLLIGTLAVLFAAVFFRDPPRIAKK | <extra_id_0> Photosynthesis <extra_id_1> Chloroplast thylakoid membrane ### Photosystem ii reaction center <extra_id_2> |
[cellular_component] <extra_id_0> [molecular_function] <extra_id_1> [biological_process] <extra_id_2> [sequence] MSGELLNAALLSFGLIFVGWALGALLLKIQGAEE | <extra_id_0> Plasma membrane-derived thylakoid membrane ### Cytochrome b6f complex <extra_id_1> Electron transfer activity <extra_id_2> Photosynthesis <extra_id_3> |
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.